Showing results for tatateleservices.com
Force lookup for edgedevicetrackmyfleet.tatateleservices.com instead
Domain Name: TATATELESERVICES.COM
Registry Domain ID: 3599055_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.corporatedomains.com
Registrar URL: http://cscdbs.com
Updated Date: 2023-12-08T06:06:32Z
Creation Date: 1998-12-13T05:00:00Z
Registry Expiry Date: 2024-12-12T05:00:00Z
Registrar: CSC Corporate Domains, Inc.
Registrar IANA ID: 299
Registrar Abuse Contact Email: domainabuse@cscglobal.com
Registrar Abuse Contact Phone: 8887802723
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: serverDeleteProhibited https://icann.org/epp#serverDeleteProhibited
Domain Status: serverTransferProhibited https://icann.org/epp#serverTransferProhibited
Domain Status: serverUpdateProhibited https://icann.org/epp#serverUpdateProhibited
Name Server: NS-1149.AWSDNS-15.ORG
Name Server: NS-151.AWSDNS-18.COM
Name Server: NS-2005.AWSDNS-58.CO.UK
Name Server: NS-792.AWSDNS-35.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2024-11-27T23:38:32Z <<<
For more information on Whois status codes, please visit https://icann.org/epp
NOTICE: The expiration date displayed in this record is the date the
registrar's sponsorship of the domain name registration in the registry is
currently set to expire. This date does not necessarily reflect the expiration
date of the domain name registrant's agreement with the sponsoring
registrar. Users may consult the sponsoring registrar's Whois database to
view the registrar's reported date of expiration for this registration.
TERMS OF USE: You are not authorized to access or query our Whois
database through the use of electronic processes that are high-volume and
automated except as reasonably necessary to register domain names or
modify existing registrations; the Data in VeriSign Global Registry
Services' ("VeriSign") Whois database is provided by VeriSign for
information purposes only, and to assist persons in obtaining information
about or related to a domain name registration record. VeriSign does not
guarantee its accuracy. By submitting a Whois query, you agree to abide
by the following terms of use: You agree that you may use this Data only
for lawful purposes and that under no circumstances will you use this Data
to: (1) allow, enable, or otherwise support the transmission of mass
unsolicited, commercial advertising or solicitations via e-mail, telephone,
or facsimile; or (2) enable high volume, automated, electronic processes
that apply to VeriSign (or its computer systems). The compilation,
repackaging, dissemination or other use of this Data is expressly
prohibited without the prior written consent of VeriSign. You agree not to
use electronic processes that are automated and high-volume to access or
query the Whois database except as reasonably necessary to register
domain names or modify existing registrations. VeriSign reserves the right
to restrict your access to the Whois database in its sole discretion to ensure
operational stability. VeriSign may restrict or terminate your access to the
Whois database for failure to abide by these terms of use. VeriSign
reserves the right to modify these terms at any time.
The Registry database contains ONLY .COM, .NET, .EDU domains and
Registrars.
Domain Name: tatateleservices.com
Registry Domain ID: 3599055_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.corporatedomains.com
Registrar URL: www.cscprotectsbrands.com
Updated Date: 2023-12-08T01:06:32Z
Creation Date: 1998-12-13T00:00:00Z
Registrar Registration Expiration Date: 2024-12-12T05:00:00Z
Registrar: CSC CORPORATE DOMAINS, INC.
Sponsoring Registrar IANA ID: 299
Registrar Abuse Contact Email: domainabuse@cscglobal.com
Registrar Abuse Contact Phone: +1.8887802723
Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited
Domain Status: serverDeleteProhibited http://www.icann.org/epp#serverDeleteProhibited
Domain Status: serverTransferProhibited http://www.icann.org/epp#serverTransferProhibited
Domain Status: serverUpdateProhibited http://www.icann.org/epp#serverUpdateProhibited
Registry Registrant ID:
Registrant Name: Tata Teleservices Limited
Registrant Organization: Tata Teleservices Limited
Registrant Street: 2A, Old Ishwar Nagar
Registrant City: New Delhi
Registrant State/Province: DL
Registrant Postal Code: 110065
Registrant Country: IN
Registrant Phone: +91.1166555692
Registrant Phone Ext:
Registrant Fax: +91.1166555692
Registrant Fax Ext:
Registrant Email: domain.management@tatatel.co.in
Registry Admin ID:
Admin Name: Tata Teleservices Limited
Admin Organization: Tata Teleservices Limited
Admin Street: 2A, Old Ishwar Nagar
Admin City: New Delhi
Admin State/Province: DL
Admin Postal Code: 110065
Admin Country: IN
Admin Phone: +91.1166555692
Admin Phone Ext:
Admin Fax: +91.1166555692
Admin Fax Ext:
Admin Email: domain.management@tatatel.co.in
Registry Tech ID:
Tech Name: Tata Teleservices Limited
Tech Organization: Tata Teleservices Limited
Tech Street: 2A, Old Ishwar Nagar
Tech City: New Delhi
Tech State/Province: DL
Tech Postal Code: 110065
Tech Country: IN
Tech Phone: +91.1166555692
Tech Phone Ext:
Tech Fax: +91.1166555692
Tech Fax Ext:
Tech Email: domain.management@tatatel.co.in
Name Server: ns-2005.awsdns-58.co.uk
Name Server: ns-792.awsdns-35.net
Name Server: ns-151.awsdns-18.com
Name Server: ns-1149.awsdns-15.org
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2023-12-08T01:06:32Z <<<
For more information on Whois status codes, please visit https://icann.org/epp
Corporation Service Company(c) (CSC) The Trusted Partner of More than 50% of the 100 Best Global Brands.
Contact us to learn more about our enterprise solutions for Global Domain Name Registration and Management, Trademark Research and Watching, Brand, Logo and Auction Monitoring, as well SSL Certificate Services and DNS Hosting.
NOTICE: You are not authorized to access or query our WHOIS database through the use of high-volume, automated, electronic processes or for the purpose or purposes of using the data in any manner that violates these terms of use. The Data in the CSC WHOIS database is provided by CSC for information purposes only, and to assist persons in obtaining information about or related to a domain name registration record. CSC does not guarantee its accuracy. By submitting a WHOIS query, you agree to abide by the following terms of use: you agree that you may use this Data only for lawful purposes and that under no circumstances will you use this Data to: (1) allow, enable, or otherwise support the transmission of mass unsolicited, commercial advertising or solicitations via direct mail, e-mail, telephone, or facsimile; or (2) enable high volume, automated, electronic processes that apply to CSC (or its computer systems). CSC reserves the right to terminate your access to the WHOIS database in its sole discretion for any violations by you of these terms of use. CSC reserves the right to modify these terms at any time.
Register your domain name at http://www.cscglobal.com